DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and AT5G43140

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_568621.1 Gene:AT5G43140 / 834331 AraportID:AT5G43140 Length:254 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:70/168 - (41%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKWL 79
            :||:|.|.....:|:.|:.:.|      :.|.......|.....|.|..|.....|:.:||:.:|
plant    89 HPFMTKSITTSVIYMAADLTSQ------MITMEPTGSFDLIRTARMASFGLIFLGPSQHLWFSYL 147

  Fly    80 DRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEG--SADIFLELREKFVPTFMRSCIFW 142
            .:..|....:...||:::.|.:..|...||||:..:.::|  |.:|...|:...:||.....::|
plant   148 SKILPKRDVLTTFKKIMMGQVLFGPVSNTVFYSYNAALQGENSEEIVARLKRDLLPTLKNGLMYW 212

  Fly   143 LPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQS 180
            .....:.|..|....:.:....|..||...|.:...|:
plant   213 PVCDFVTFKYVPVHLQPLMNSSCAYIWTIYLTYMANQT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 13/63 (21%)
AT5G43140NP_568621.1 Mpv17_PMP22 185..248 CDD:282035 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.