DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and PMP22

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001319865.1 Gene:PMP22 / 825777 AraportID:AT4G04470 Length:190 Species:Arabidopsis thaliana


Alignment Length:119 Identity:31/119 - (26%)
Similarity:55/119 - (46%) Gaps:5/119 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PTLYLWYKWLDRAFPGTTKV-IIVKKLVLDQFVLTP--YLLTVFYAGMSIMEGSADIFLELREKF 131
            |..:.::.:||:.|.|.... .:.||::|:|..|:|  :||.:.|.|:.|......:..|..:|.
plant    68 PAGHFFHTYLDKFFKGKKDTQTVAKKVILEQLTLSPLNHLLFMIYYGVVIERTPWTLVRERIKKT 132

  Fly   132 VPTFMRSCIFWLPAQA-LNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSLPVA 184
            .||...:...:.|... :|:..|...||||...:....| .|....:.:|:.:|
plant   133 YPTVQLTAWTFFPVVGWINYKYVPLHFRVILHSLVAFFW-GIFLTLRARSMTLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 14/62 (23%)
PMP22NP_001319865.1 Mpv17_PMP22 116..175 CDD:397992 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.