DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and AT3G24570

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_189100.1 Gene:AT3G24570 / 822053 AraportID:AT3G24570 Length:235 Species:Arabidopsis thaliana


Alignment Length:203 Identity:46/203 - (22%)
Similarity:83/203 - (40%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VTNSAIYGSLYVGAEYSQQFASKR---WLATASKPEDID----------------YATIGRYAVM 63
            :::..::|...|.|:|.....:||   .|...:|..|.|                :..:...::.
plant    22 ISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADADAEIKVKWKQDAEFKVNWKRVAITSMF 86

  Fly    64 GTAVYAPTLYLWYKWLD-------RAFPGTTKVIIVKKLVLDQFVLTPYLLTVF--YAGMSIMEG 119
            |.....|..:.||:.||       |..|.:|: .:..|:.:|..:..|..|.||  |.|.:..:.
plant    87 GFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTR-FVAAKVAMDGLIFGPVDLLVFFTYMGFATGKN 150

  Fly   120 SADIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSLPVA 184
            :|::...|:..|:|........|...|..||..|..:::::|:.|..|:....|.|.::|. ..|
plant   151 TAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFCLVDSAFLSWVEQQK-DAA 214

  Fly   185 TKEIATDS 192
            .|:..|.|
plant   215 WKQWFTSS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 14/61 (23%)
AT3G24570NP_189100.1 Mpv17_PMP22 144..205 CDD:397992 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.