DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and AT2G14860

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:173 Identity:39/173 - (22%)
Similarity:75/173 - (43%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPED-IDYATIGRYAVMGTAVYAPTLYLWYKW 78
            :|.||.|.....:|:.|:.|.|..:|    |:|:..| :..|.:|.|   |..|..|||:.|:.:
plant    84 HPVVTKSVTSSLIYIAADLSSQTIAK----TSSESYDLVRTARMGGY---GLFVLGPTLHYWFNF 141

  Fly    79 LDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEG--SADIFLELREKFVPTFMRSCIF 141
            :.|.||....:...||:.:.|.:..|.:..:|::..:.::|  .:.|...|:...:|......::
plant   142 MSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVMY 206

  Fly   142 WLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSLPVA 184
            |.....:.|.......:.:.......:|...:.:...:..|||
plant   207 WPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTYMANREKPVA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 7/63 (11%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 7/62 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.