DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and si:ch211-120k19.1

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001313499.1 Gene:si:ch211-120k19.1 / 563199 ZFINID:ZDB-GENE-100922-282 Length:231 Species:Danio rerio


Alignment Length:223 Identity:57/223 - (25%)
Similarity:97/223 - (43%) Gaps:50/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFHRYPFVTNSAIYGSLYVGAEYSQQ--------------------FASKRW-LATASKPED--- 51
            ||..:|::.|...|.:|:..|:..||                    .:.:|: ::...|.:|   
Zfish     7 LFKSHPYIPNVVGYTTLFATADLIQQGVMGKAQDKETEQEVQDTLKTSIERFTVSKEGKTDDLTL 71

  Fly    52 --------------------------IDYATIGRYAVMGTAVYAPTLYLWYKWLDRAFPGTTKVI 90
                                      ||::...|.|::|...:|...|.|.:.|:|.|||.....
Zfish    72 YNAKTNDAGNQTLSEMQHVPQFHRSFIDWSQTARVALVGFCFHANFNYYWLRGLERMFPGGGTKR 136

  Fly    91 IVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALNFSLVAP 155
            :..|::|||.:..|..::.||.|:|.:||:.|.|.:.:.||..::....::|...||:||||:.|
Zfish   137 VSLKVILDQLIAAPMTISAFYIGLSTLEGAEDPFEDWKNKFWTSYKTGVVYWSTMQAVNFSLIPP 201

  Fly   156 RFRVIYMGICGLIWVNILCWTKRQSLPV 183
            ..|.:::|...|.|...||..|:|...|
Zfish   202 AARTVFVGGVALGWTIFLCHFKQQKSDV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 20/61 (33%)
si:ch211-120k19.1NP_001313499.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4935
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - otm26326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5861
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.