DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and mpv17l

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_691639.1 Gene:mpv17l / 563178 ZFINID:ZDB-GENE-120215-229 Length:199 Species:Danio rerio


Alignment Length:165 Identity:53/165 - (32%)
Similarity:88/165 - (53%) Gaps:9/165 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKWLD 80
            |:::|..:||.|:.|.::..|..::|        :::|:......|::..:......|.|.:.|:
Zfish    16 PWISNVTLYGCLFAGGDFVHQCIAQR--------DEMDWRHTRNVAIVALSFQGNFNYFWLRALE 72

  Fly    81 RAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWLPA 145
            ..|||.:..::.:||||||...:|...:|||.|:|.:||..|||.:.||||..|:....::|...
Zfish    73 SRFPGRSAGMVFRKLVLDQSFASPLATSVFYTGVSFLEGKEDIFEDWREKFFNTYKTGLMYWPFM 137

  Fly   146 QALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQS 180
            |.|||.|:....|..:||....:|...||:: |||
Zfish   138 QFLNFVLMPLYLRTAFMGCSAFVWATFLCFS-RQS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 22/61 (36%)
mpv17lXP_691639.1 Mpv17_PMP22 108..167 CDD:282035 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10764
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13547
Inparanoid 1 1.050 104 1.000 Inparanoid score I4935
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - otm26326
orthoMCL 1 0.900 - - OOG6_110111
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.