DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and mpv17l2

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001004930.1 Gene:mpv17l2 / 448319 XenbaseID:XB-GENE-1002324 Length:222 Species:Xenopus tropicalis


Alignment Length:189 Identity:56/189 - (29%)
Similarity:89/189 - (47%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RYPFVTNSAIYGSLY-VGAEYSQQFASKR-------WLATASKPEDIDYATIGRYAVMGTAVYAP 70
            |:..|||:...|.|. :|....|....:|       ||.|            ||...:|.:: .|
 Frog    23 RFLIVTNTVSCGLLLGIGDSIQQSREVRRDPERKRDWLRT------------GRMFAIGCSM-GP 74

  Fly    71 TLYLWYKWLDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGS--ADIFLELREKFVP 133
            .::.||.||||:|||....::::|:::||.|.:|.|...::.||..|||.  ...:.|.||||..
 Frog    75 LMHFWYSWLDRSFPGRGITVVMRKVLIDQLVASPVLGLWYFLGMGSMEGQKLEKSWQEFREKFWE 139

  Fly   134 TFMRSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSLPVATKEIATDS 192
            .:......|..||.:||..::|::||||:.:..:.|...|.:.|.:........:.|.|
 Frog   140 FYKADWTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKHRKEECVENTMGTSS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 20/63 (32%)
mpv17l2NP_001004930.1 Mpv17_PMP22 119..180 CDD:367825 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.