DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and plh

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_649511.2 Gene:plh / 40615 FlyBaseID:FBgn0037292 Length:193 Species:Drosophila melanogaster


Alignment Length:187 Identity:46/187 - (24%)
Similarity:82/187 - (43%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLFHRYPFVTNSAIYGSLY-VGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLY 73
            |:..:|..:.....||:|: .|:...|....|:...|      .|:....|:::.|.....||:|
  Fly     7 NITSKYKVLRGMISYGTLWPCGSLIEQTMIEKKTFRT------YDWMKCLRFSLFGFFFMGPTIY 65

  Fly    74 LWYKWLDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGS--ADIFLELREKFVPTFM 136
            :|.:.....:|.|.....:.|.:.:|....|..::.|...|::|||:  |:...|:.:||:..:.
  Fly    66 VWIRLASVMWPRTDIKSSLCKAITEQTAYDPMAISSFLFFMTLMEGNSYAEAKREVSDKFLDAYK 130

  Fly   137 RSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSL--PVATKEIATD 191
            ...|:|...|.:||:.|..|.:|::.....:.|...|.:.|...|  ||.....|.|
  Fly   131 VGVIYWPCVQTVNFAFVPARNQVVFTSFFSMCWTTFLAYVKFLQLHPPVDVDHHALD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 17/63 (27%)
plhNP_649511.2 Mpv17_PMP22 108..171 CDD:282035 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
65.920

Return to query results.
Submit another query.