DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and CG7970

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:197 Identity:46/197 - (23%)
Similarity:78/197 - (39%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VRNLFHRYPFVTNSAIYGSLYVGAEY-SQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPT 71
            :..||: :|..|.|.....|...|.. ||:.|..:.|         :..::..|.:.|.......
  Fly    79 LEQLFN-HPVRTKSITACVLATSANVTSQRLAGAKTL---------NQQSVFAYGLFGLIFGGSV 133

  Fly    72 LYLWYKWLDRAFPGTTKVIIVKKLVLDQFVLTP--YLLTVFYAGMSIMEG-SADIFLELREKFVP 133
            .:.:|..::|.|....:.......:.::.|..|  ..|::|:  :::.|| |....|:..||   
  Fly   134 PHYFYTTVERLFSQDVRFRRFFLFLSERLVYAPIYQALSLFF--LALFEGKSPSTALKNVEK--- 193

  Fly   134 TFMRSCIFWLPAQA----------LNFSLVAPRFRVIYMGICGLIWVNILCWTKRQ-SLPVATKE 187
                  ::|...:|          |||:.|.|.||.|.|.|...|||..:...:|: ...:|.||
  Fly   194 ------LYWPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAAKE 252

  Fly   188 IA 189
            .|
  Fly   253 AA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 21/72 (29%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.