DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and CG14777

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster


Alignment Length:165 Identity:46/165 - (27%)
Similarity:73/165 - (44%) Gaps:8/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKWL 79
            :|....:..|..::......||....|      |..:.|:|...|:::.|....|||||.|.:..
  Fly    23 HPMAKGALTYAVMWPAGSLIQQAMEGR------KLREYDWARALRFSLFGALYVAPTLYGWVRLT 81

  Fly    80 DRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIME--GSADIFLELREKFVPTFMRSCIFW 142
            ...:|.|.....:.|.:.:|....|:....|:.|||::|  ..:....|.:||..||:......|
  Fly    82 SAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIW 146

  Fly   143 LPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTK 177
            ...|.:|||||....||:::.||.|:|...|.:.|
  Fly   147 PILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 21/64 (33%)
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5861
SonicParanoid 1 1.000 - - X1515
76.950

Return to query results.
Submit another query.