DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_008769309.1 Gene:Mpv17l2 / 290645 RGDID:1308064 Length:206 Species:Rattus norvegicus


Alignment Length:195 Identity:55/195 - (28%)
Similarity:84/195 - (43%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLISGVRNLFH-RYPFVTNSAIYGSLY-----------VGAEYSQQFASKRWLATASKPEDIDYA 55
            :.::..|.||. |...|||:...|.|.           |.|...|:|:::|              
  Rat    11 KALAAGRPLFQGRALLVTNTLGCGVLMATGDGARQAWEVRARPEQRFSARR-------------- 61

  Fly    56 TIGRYAV---MGTAVYAPTLYLWYKWLDRAFPGT---TKVIIVKKLVLDQFVLTPYLLTVFYAGM 114
            :...:||   ||     |.|:.||.||||..|.:   :...::||:::||.|.:|.|...::.|:
  Rat    62 SASMFAVGCSMG-----PFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGL 121

  Fly   115 SIMEGSA--DIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTK 177
            ..:||..  :...|||.||...:......|..||.:||..:...|||.|:....|.|...|.:.|
  Rat   122 GSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLK 186

  Fly   178  177
              Rat   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 20/64 (31%)
Mpv17l2XP_008769309.1 Mpv17_PMP22 124..186 CDD:282035 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.