DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and SPAC4G9.14

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_593696.1 Gene:SPAC4G9.14 / 2543598 PomBaseID:SPAC4G9.14 Length:221 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:49/204 - (24%)
Similarity:80/204 - (39%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISGVRNLFHRYPFVTNSAIYGSLYVGAEYSQQ---------FASKRWL------------ATASK 48
            :|...:.:...|.:|...:..||...::...|         |.:||.:            |:.||
pombe    22 VSRFNDKYELQPLLTLGLLNASLTALSDLLAQALDSYKLLKFRNKRDVSLEKYGNTILLPASTSK 86

  Fly    49 PEDIDYATIGRYAVMGTAVYAPTLYLWYKWLDRAFPGTTKVI-IVKKLVLDQFVLTPYLLTVFYA 112
               :|.....|||..|..: .|..:.|:..|..........| ||.::.||||:..|..:..|:.
pombe    87 ---LDVHRTIRYAAYGLCL-TPIQFRWFVALSNVIQTENPFIAIVLRVALDQFIFAPLGIVFFFL 147

  Fly   113 GMSIMEGSADIFLE--LREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCW 175
            .|.|.|..:...|:  .|:.:.||...:.|.|...|..||:.|....:||:.....::|...|  
pombe   148 FMGITECKSYERLKSYFRKHYWPTLKANYILWPAVQLFNFTFVPLVLQVIFANAVSMVWTAYL-- 210

  Fly   176 TKRQSLPVA 184
            :.:.|.|.|
pombe   211 SLKNSSPNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 16/63 (25%)
SPAC4G9.14NP_593696.1 Mpv17_PMP22 151..215 CDD:282035 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.