DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and mpv17l

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_002938322.1 Gene:mpv17l / 100493944 XenbaseID:XB-GENE-5755324 Length:203 Species:Xenopus tropicalis


Alignment Length:175 Identity:57/175 - (32%)
Similarity:100/175 - (57%) Gaps:6/175 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RYPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKW 78
            |:|::||..|||||:..|:..||..||      |..|.||:....:..::|...:|...:.|.::
 Frog    10 RHPWLTNVTIYGSLFASADIVQQKLSK------SPGEPIDFKQTAKVGIVGFCFHANFNFFWLRF 68

  Fly    79 LDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWL 143
            ::|.|||:..:.:::|:..||.:..|..::.||.|:|:::|.:|||..|:|||.||:....:.|.
 Frog    69 IERTFPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGESDIFKNLKEKFWPTYKTGVMCWT 133

  Fly   144 PAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQSLPVATKEI 188
            ..|.:|||::.|..|..|:|:|..:|...||:.:.:.:...|..:
 Frog   134 VFQTINFSVIPPFVRTAYIGVCAFLWTTFLCYIRNRDINEVTSRL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 23/61 (38%)
mpv17lXP_002938322.1 Mpv17_PMP22 105..164 CDD:367825 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9225
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13547
Inparanoid 1 1.050 133 1.000 Inparanoid score I4487
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - oto103658
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.