DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and Mpv17l

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_008765688.1 Gene:Mpv17l / 100362572 RGDID:2324483 Length:194 Species:Rattus norvegicus


Alignment Length:165 Identity:56/165 - (33%)
Similarity:86/165 - (52%) Gaps:9/165 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RYPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKW 78
            |||:.||..:|..|:...:..||         ..:....|:....|.|.:....:....|:|.:.
  Rat    14 RYPWPTNVLLYAGLFSAGDALQQ---------RLRGGPADWRQTRRVATLALTFHGNFNYMWLRL 69

  Fly    79 LDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWL 143
            |:||.||.....::.|::.||.|..|..|:.||.||||::|..||||:||:||..|:....::|.
  Rat    70 LERALPGRAPRTVLAKVLCDQTVGGPVALSAFYVGMSILQGKDDIFLDLRQKFWNTYKTGLMYWP 134

  Fly   144 PAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKR 178
            ..|..|||||...:|..|.|:||.:|...||::::
  Rat   135 FVQLTNFSLVPVNWRTAYTGLCGFLWATFLCFSQQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 26/61 (43%)
Mpv17lXP_008765688.1 Mpv17_PMP22 106..165 CDD:397992 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10092
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13547
Inparanoid 1 1.050 110 1.000 Inparanoid score I4795
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - oto96964
orthoMCL 1 0.900 - - OOG6_110111
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.