DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33217 and PELP1

DIOPT Version :9

Sequence 1:NP_996147.1 Gene:CG33217 / 2768951 FlyBaseID:FBgn0053217 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_055204.4 Gene:PELP1 / 27043 HGNCID:30134 Length:1130 Species:Homo sapiens


Alignment Length:536 Identity:109/536 - (20%)
Similarity:216/536 - (40%) Gaps:82/536 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TLKNRRRRSL-----GLRLLICYLKKSDIKL-EENVNTWTYLLVQSCKLPELCSYGDLIFSAMAL 66
            :|.|.|..|:     ||.||...:.:|..:| :::..:|...:.|..:..:..:..:|   |:|:
Human    93 SLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMEL---AVAV 154

  Fly    67 LLDKIQSDGNVSKVF---ASAHLSKVL--------ECLSHNEIYKHNRSTIAALHTIKKCLKYYP 120
            |.|.::....:..:|   :..||..:|        ||..            :||..:|.|:.|:|
Human   155 LRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQ------------SALEGMKACMTYFP 207

  Fly   121 KGIKTKSSSIKNILVLLIDSQNDEVVYQSGECWFLLHKIHGISDKEHMDNKTEWKDFQLSLLSNI 185
            :...:....:.:..:..:|:.:.::...:.||:..|..: |....:.:.:...|:....|||:::
Human   208 RACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSL-GAGFSQGLKHTESWEQELHSLLASL 271

  Fly   186 QYIINRTIVMPDESVNSPFMPNHFGAFTFVAVKDPFERASKAFRRIFN-LIEYIKIALSKQFVFK 249
            ..::.   .:.:.:..:|......|....::.:|.........|:.|: |...:.:.||.:|...
Human   272 HTLLG---ALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAP 333

  Fly   250 KNICVHQILSLIQNGLNAHVNQQNVRI--NHAYLETFFPQMHIKLLELLEIVIKTCHTHLRMDFR 312
            .::.|.:||..|...|:  |:.:|:.:  :........|.:|::.|:||..:|..|.:.|.....
Human   334 VSVPVQEILDFICRTLS--VSSKNISLHGDGPLRLLLLPSIHLEALDLLSALILACGSRLLRFGI 396

  Fly   313 LVLNILMEALE--KTNKSMLLESNLKEVLNMRLVVYRVISLW---CST----LQEGSHCEIIADT 368
            |:..:|.:.|.  ...:..|.....:....:|..||.::.||   |..    ||.|:..|.:...
Human   397 LIGRLLPQVLNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTH 461

  Fly   369 LIKEV---FDDILTRSP---------TTKKSVNAPYMKLSPETLFSMLKCSLSNEDYRMLSQQAH 421
            |:.::   .|.:..|||         |.|.|        :|:.|...:..:::...:|.....|:
Human   462 LLSDISPPADALKLRSPRGSPDGSLQTGKPS--------APKKLKLDVGEAMAPPSHRKGDSNAN 518

  Fly   422 S--C------LQQFLLSSGHLIKHQLLKAVHHTLLGIC--VQMHSQSSKEPDLWDIWDGRLEVYK 476
            |  |      |.:.:|..|.|||.:..:.:|..:|.:.  ||........|  :.....|.|:|.
Human   519 SDVCAAALRGLSRTILMCGPLIKEETHRRLHDLVLPLVMGVQQGEVLGSSP--YTSSRCRRELYC 581

  Fly   477 SFTVLLKLRNYGCPTP 492
            ....||...:..||.|
Human   582 LLLALLLAPSPRCPPP 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33217NP_996147.1 None
PELP1NP_055204.4 Required for modulation of ESR1 transcriptional activity. /evidence=ECO:0000269|PubMed:14963108 2..80
LXXLL motif 1 33..37
LXXLL motif 2 69..73
LXXLL motif 3 111..115 2/3 (67%)
Required for modulation of ESR1 transcriptional activity. /evidence=ECO:0000269|PubMed:14963108 121..189 12/70 (17%)
LXXLL motif 4 155..159 2/3 (67%)
LXXLL motif 5 177..181 1/3 (33%)
LXXLL motif 6 264..268 1/3 (33%)
LXXLL motif 7 271..275 0/3 (0%)
LXXLL motif 8 364..368 0/3 (0%)
LXXLL motif 9 459..463 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 473..497 7/31 (23%)
LXXLL motif 10 579..583 1/3 (33%)
LXXLL motif 11 584..588 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..1130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D159602at33208
OrthoFinder 1 1.000 - - FOG0007057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107783
Panther 1 1.100 - - LDO PTHR34105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.