DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and CG34189

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster


Alignment Length:68 Identity:28/68 - (41%)
Similarity:37/68 - (54%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CSVNGTQTDCPTACPETCDTKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCP----KIVLQ 87
            |..|.|...|...|||||..|.. .|...||..|||||.||.|..:..|:|::|||    ::|::
  Fly    53 CGENATMVRCAGVCPETCAFKSL-KCPKYCGVNCVCKPDYVFNENLQLCILKTDCPLDIKQLVVE 116

  Fly    88 SDR 90
            :.|
  Fly   117 THR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 23/53 (43%)
CG34189NP_001097347.1 TIL 53..106 CDD:280072 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138202at33392
OrthoFinder 1 1.000 - - FOG0014389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.