DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and Acp62F

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster


Alignment Length:85 Identity:51/85 - (60%)
Similarity:61/85 - (71%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVDCSVNGTQTDCPTACPETCDTKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPK-IVLQ 87
            ||||:.|||||:||.||||||:..|...|..:||.|||||||||:|..|||||||||||| :|.:
  Fly    31 KVDCTANGTQTECPVACPETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRK 95

  Fly    88 SDRARRLTNFNCFSGENTCT 107
            .|....::||.|||....|:
  Fly    96 EDMLLGVSNFKCFSRNYNCS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 36/53 (68%)
Acp62FNP_523892.1 TIL 34..88 CDD:280072 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4105
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138202at33392
OrthoFinder 1 1.000 - - FOG0014389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.