powered by:
Protein Alignment CG33259 and CG45546
DIOPT Version :9
Sequence 1: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287583.1 |
Gene: | CG45546 / 19835889 |
FlyBaseID: | FBgn0267106 |
Length: | 93 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 24/55 - (43%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 CSVNGTQTDCPTACPETCDTKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDC 81
||.....:.| .:|..:|..:...:|...|...|:||.|:: |....|:..|.|
Fly 37 CSSKEIVSPC-RSCERSCGQRETLDCVKDCRYGCICKMGWI--RRNSTCIPMSQC 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33259 | NP_996090.1 |
TIL |
27..81 |
CDD:280072 |
14/53 (26%) |
CG45546 | NP_001287583.1 |
TIL |
37..88 |
CDD:280072 |
14/53 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.