DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and CG45546

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001287583.1 Gene:CG45546 / 19835889 FlyBaseID:FBgn0267106 Length:93 Species:Drosophila melanogaster


Alignment Length:55 Identity:15/55 - (27%)
Similarity:24/55 - (43%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CSVNGTQTDCPTACPETCDTKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDC 81
            ||.....:.| .:|..:|..:...:|...|...|:||.|::  |....|:..|.|
  Fly    37 CSSKEIVSPC-RSCERSCGQRETLDCVKDCRYGCICKMGWI--RRNSTCIPMSQC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 14/53 (26%)
CG45546NP_001287583.1 TIL 37..88 CDD:280072 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.