DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and T06E6.10

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_506835.1 Gene:T06E6.10 / 188189 WormBaseID:WBGene00011540 Length:249 Species:Caenorhabditis elegans


Alignment Length:90 Identity:23/90 - (25%)
Similarity:33/90 - (36%) Gaps:23/90 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CSFSAVKCFAEKVD-------------------CSVNGTQTDCPTACPET-CDTKGKPNCTLICG 57
            |:...|:||....|                   |..|.....|...|.:| |:.|.| .|..:|.
 Worm   152 CALHTVQCFTTPCDPVAKCETPLNFLSEPFNPGCGPNEHFVGCKNICSDTKCNEKRK-MCPAVCT 215

  Fly    58 GP-CVCKPGYVVNRMIPACVLRSDC 81
            .| |||..|:..::. ..||.:.:|
 Worm   216 FPGCVCLNGFFRDKH-DKCVTQEEC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 17/55 (31%)
T06E6.10NP_506835.1 TIL 185..239 CDD:366828 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D644488at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.