DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and C53B7.2

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:86 Identity:27/86 - (31%)
Similarity:38/86 - (44%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCDTKGKPNCTLICGGP-CVCKPGYVVN---R 70
            |||...|.......:|.|.:|...:.|...||.||::. .|.|.:.|..| |.|.||:|.:   :
 Worm    12 VVLVVDSQYHQTTTQVSCGINEQYSPCTQMCPPTCESP-NPQCRVDCTRPSCTCLPGHVYSNSRQ 75

  Fly    71 MIPA----------CVLRSDC 81
            .|||          |.:.:||
 Worm    76 CIPANSCYQTQSLRCRMNNDC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 20/67 (30%)
C53B7.2NP_509154.2 TIL 29..82 CDD:366828 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.