powered by:
Protein Alignment CG33259 and C25E10.8
DIOPT Version :9
Sequence 1: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370492.1 |
Gene: | C25E10.8 / 182892 |
WormBaseID: | WBGene00016097 |
Length: | 137 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 27/65 - (41%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 CFAEKVDCSVNGTQTDCPTACPETCDTKGKPNCTLIC-GGPCVCKPGYVVNRMIPACVLRSDCPK 83
|..|...|..|.|...|.|||..||:..|...||..| ...|.|..|:|.|.. .|....:|||
Worm 75 CTKETSKCPENETFFRCGTACEPTCEKPGPRPCTRQCIVNVCQCSSGFVRNGY--RCTELKECPK 137
Fly 84 83
Worm 138 137
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.