DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and C10G8.4

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_504416.1 Gene:C10G8.4 / 182503 WormBaseID:WBGene00015683 Length:98 Species:Caenorhabditis elegans


Alignment Length:80 Identity:25/80 - (31%)
Similarity:33/80 - (41%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCDTKGKPNCTLIC-GGPCVCKPGY 66
            |:....||.:.:.:|.:...::  |..|.....|.|||..||.......|||.| ...|.|..|:
 Worm    18 KFLIILLVAIVTITAAQGRYQR--CPSNEEFRSCGTACEPTCQNPNPQVCTLQCILNVCQCSQGF 80

  Fly    67 VVNRMIPACVLRSDC 81
            |  |....||...||
 Worm    81 V--RGPNGCVPPQDC 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 19/54 (35%)
C10G8.4NP_504416.1 TIL 40..93 CDD:366828 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4105
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.