DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and Y69H2.3

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001360619.1 Gene:Y69H2.3 / 180221 WormBaseID:WBGene00013481 Length:826 Species:Caenorhabditis elegans


Alignment Length:92 Identity:29/92 - (31%)
Similarity:37/92 - (40%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AEKVDCSVNGTQTDCPTACPE-TCDTKGKP--NCTLICGGPCVCKPGYVVNRMIPACVLRSDCPK 83
            |..:.|.||....:|...|.| .|..|..|  ||.:.|...|.|..|:|.|.. ..||..::||.
 Worm    94 ATNLTCPVNEVSNECHNPCTEKKCPQKNAPQVNCLMACQVGCSCMDGFVRNNQ-GVCVKEAECPA 157

  Fly    84 IVLQSDRARRLTNFNCFSGENTCTQLK 110
            |..|:.......| .|   .|.|.:.|
 Worm   158 IGSQTCGTNEEPN-QC---HNACFEKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 19/56 (34%)
Y69H2.3NP_001360619.1 TIL 26..80 CDD:366828
TIL 99..155 CDD:366828 19/56 (34%)
TIL 163..219 CDD:366828 5/22 (23%)
TIL 228..284 CDD:366828
TIL 588..643 CDD:366828
TIL 710..766 CDD:366828
TIL 772..826 CDD:366828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.