powered by:
Protein Alignment CG33259 and LOC101733954
DIOPT Version :9
Sequence 1: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012823040.1 |
Gene: | LOC101733954 / 101733954 |
-ID: | - |
Length: | 153 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 36/73 - (49%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 SFSAVKCFAEKVDCSVNGTQTDCPTACPETCDTKGKPNCTL-ICGGPCVCKPGYVV-NRMIPACV 76
|.:.|...|.||.|..:.|...|.|...::|.||..|..:. .|...|||..||:: :...|.|:
Frog 79 SNTCVPVSACKVSCPQHSTFIPCYTHSRKSCRTKDDPETSSGTCSPRCVCDKGYILSDEPDPRCI 143
Fly 77 LRSDCPKI 84
..|:||||
Frog 144 KISECPKI 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.