DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and LOC101733954

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_012823040.1 Gene:LOC101733954 / 101733954 -ID:- Length:153 Species:Xenopus tropicalis


Alignment Length:73 Identity:26/73 - (35%)
Similarity:36/73 - (49%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SFSAVKCFAEKVDCSVNGTQTDCPTACPETCDTKGKPNCTL-ICGGPCVCKPGYVV-NRMIPACV 76
            |.:.|...|.||.|..:.|...|.|...::|.||..|..:. .|...|||..||:: :...|.|:
 Frog    79 SNTCVPVSACKVSCPQHSTFIPCYTHSRKSCRTKDDPETSSGTCSPRCVCDKGYILSDEPDPRCI 143

  Fly    77 LRSDCPKI 84
            ..|:||||
 Frog   144 KISECPKI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 17/55 (31%)
LOC101733954XP_012823040.1 TIL 32..88 CDD:366828 2/8 (25%)
TIL 92..148 CDD:366828 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.