DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and LOC100494280

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_031757174.1 Gene:LOC100494280 / 100494280 -ID:- Length:3059 Species:Xenopus tropicalis


Alignment Length:120 Identity:28/120 - (23%)
Similarity:41/120 - (34%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVVLCSFSAVKCFAEKV-DCSVNGTQTDCPTACPET--------CDTKGKPNCTLICGGPCVCKP 64
            ::..|:...:.|...:: ||........|..|.|.|        |:|......:..|...|||..
 Frog   749 VICTCTQGKLNCTGNEISDCVDPMVYISCKNATPGTPGAECFKSCETLDMHCYSKRCIPGCVCPN 813

  Fly    65 GYVVNRMIPACVLRSDCPKI-----VLQSDRARRLTN--------FNCFSGENTC 106
            |.|.:.. ..|:..:|||.|     ....|..:...|        :||  .||.|
 Frog   814 GLVFDGK-GGCIRDTDCPCIHNEAMYAPGDEIKIRCNTCVCKDRMWNC--TENVC 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 14/61 (23%)
LOC100494280XP_031757174.1 VWD 50..195 CDD:395046
C8 237..303 CDD:214843
TIL 306..362 CDD:410995
VWD 391..555 CDD:214566
C8 594..660 CDD:214843
TIL 672..729 CDD:410995
TIL 768..829 CDD:410995 14/61 (23%)
VWD 858..1015 CDD:214566 5/10 (50%)
C8 1055..1127 CDD:214843
Mucin2_WxxW 1313..1398 CDD:404246
Mucin2_WxxW 1522..1607 CDD:404246
PHA03255 <1623..>1729 CDD:165513
Mucin2_WxxW 1747..1832 CDD:404246
VWD 2272..2439 CDD:214566
C8 2485..2547 CDD:400886
CT 2962..3041 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.