powered by:
Protein Alignment CG33259 and LOC100487636
DIOPT Version :9
Sequence 1: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017951275.2 |
Gene: | LOC100487636 / 100487636 |
-ID: | - |
Length: | 134 |
Species: | Xenopus tropicalis |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 28/61 - (45%) |
Gaps: | 5/61 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 EKVDCSVNGTQTDCPTACPETCDTKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPK 83
|.:.|......|.|...||.||..|| |..||...|:||.||..:. ..|:..|:|||
Frog 79 ECIICEELKVYTPCNKFCPPTCKPKG---CIEICAPGCICKQGYAWHN--EKCIPESECPK 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33259 | NP_996090.1 |
TIL |
27..81 |
CDD:280072 |
19/53 (36%) |
LOC100487636 | XP_017951275.2 |
TIL |
83..132 |
CDD:410995 |
19/53 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.