DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and AT2G45695

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001078064.1 Gene:AT2G45695 / 5007965 AraportID:AT2G45695 Length:101 Species:Arabidopsis thaliana


Alignment Length:101 Identity:49/101 - (48%)
Similarity:71/101 - (70%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLD-----GKQKWTIANLLKWMHANILTERPELFLQGDTVRP 65
            :::.|||..|.|||..:.|..::|:|     ....:|:.:||.|:..|::.||||:|::||||||
plant     1 MQLTLEFGGGLELLCDSEKIHKVNVDLPNGADSDDFTMKHLLSWVRTNLIKERPEMFMKGDTVRP 65

  Fly    66 GILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            |:|||:||.||||.|:||..::..|.|:||||||||
plant    66 GVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 47/98 (48%)
AT2G45695NP_001078064.1 Urm1 2..101 CDD:370315 47/98 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2232
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41688
Inparanoid 1 1.050 105 1.000 Inparanoid score I2123
OMA 1 1.010 - - QHG53739
OrthoDB 1 1.010 - - D1541629at2759
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - otm3214
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.