DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and urm1

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_587744.2 Gene:urm1 / 2538765 PomBaseID:SPCC548.04 Length:97 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:43/99 - (43%)
Similarity:62/99 - (62%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTERP---ELFLQGDTVRPGI 67
            :.|.:|...|.:|||...|...|:|.......:.:|:.:| |.|: |:|   :||:...||||||
pombe     1 MAIKVELLGGLDLLFNKQKALSLSLSNLGSTKLGSLIDYM-AQII-EKPSQKDLFILNGTVRPGI 63

  Fly    68 LVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            :||:||.|||||.:.:|.|:..|.|:|:||||||
pombe    64 IVLVNDQDWELLEKEEYNLEEGDEVVFVSTLHGG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 41/96 (43%)
urm1NP_587744.2 Urm1 3..97 CDD:176360 41/95 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I2420
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1878
OMA 1 1.010 - - QHG53739
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto101759
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1611
SonicParanoid 1 1.000 - - X3670
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.