DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and urm-1

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001255080.1 Gene:urm-1 / 13191153 WormBaseID:WBGene00185048 Length:100 Species:Caenorhabditis elegans


Alignment Length:100 Identity:35/100 - (35%)
Similarity:57/100 - (56%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTE--RPELFLQGDT--VRPG 66
            :.:.::||.|||.|   :|.:...:......|:.::||::..|::|:  |..:.|..|.  |..|
 Worm     4 IPVTIDFSGGAEFL---VKAKAQKVQIPADSTLRDVLKFVRDNLVTDVHRINMLLNDDASEVAHG 65

  Fly    67 ILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            ::.||||||..||.|.|..::..|.:.|:||||||
 Worm    66 VITLINDTDTGLLLEYDTVIEAGDTITFVSTLHGG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 33/97 (34%)
urm-1NP_001255080.1 UBQ 6..100 CDD:294102 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165188
Domainoid 1 1.000 59 1.000 Domainoid score I7120
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53739
OrthoDB 1 1.010 - - D1541629at2759
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto18471
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.