DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and urm1

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_017952401.1 Gene:urm1 / 100379922 XenbaseID:XB-GENE-993481 Length:108 Species:Xenopus tropicalis


Alignment Length:88 Identity:57/88 - (64%)
Similarity:69/88 - (78%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVRPGILVLINDTDWEL 78
            ||||||..||:.::.|..:.. |.|..||.|:..|:|.||||||:|||||||||||||||.||||
 Frog    21 GAELLFDGIKQHQVTLPNQSNPWDIRQLLVWIRHNLLKERPELFIQGDTVRPGILVLINDADWEL 85

  Fly    79 LGELDYELQPNDNVLFISTLHGG 101
            :|||||:|:..||::||||||||
 Frog    86 MGELDYQLEDKDNIVFISTLHGG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 55/86 (64%)
urm1XP_017952401.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5481
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41688
Inparanoid 1 1.050 124 1.000 Inparanoid score I4562
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541629at2759
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto104728
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.