DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pura and CG15611

DIOPT Version :9

Sequence 1:NP_996016.2 Gene:Pura / 2768948 FlyBaseID:FBgn0035802 Length:1904 Species:Drosophila melanogaster
Sequence 2:NP_611189.2 Gene:CG15611 / 36930 FlyBaseID:FBgn0034194 Length:508 Species:Drosophila melanogaster


Alignment Length:468 Identity:112/468 - (23%)
Similarity:180/468 - (38%) Gaps:128/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1258 EQQSKIADSGLGVCDNCERNPKLARI--CSCQSLNEK-------------SH--------DELLE 1299
            |:|..:.||..|:        .|:.|  ||..:.|..             ||        ||..|
  Fly    85 EKQISLLDSDSGI--------SLSSINTCSTTAANSSPTYRAPNGFHSFPSHTLSFETLGDEYHE 141

  Fly  1300 DECFDRPSKRYMDIMHSPMEANAHLQCHGSSLELPKLEELSCLDPKIQKTLLLIMREMIGTERDY 1364
            ||                           .:|.|..|......:....|.:..|:.|:|.||.:|
  Fly   142 DE---------------------------DTLSLENLFPCDQTEIYASKKISFIIDELIQTEVNY 179

  Fly  1365 VRSLYYVIENYIDELLREDIPQPLRGQ--RNVIFGNIEKIFEFHNSHFLGELERYERNPLKVG-- 1425
            |.:|...:.||......||:|:.|.|:  :.::.|||::|.|.|....|..:.|.:|: || |  
  Fly   180 VNNLKKGMLNYGQLKDVEDLPEALSGETKQKMLLGNIKEILELHEKEILPLMLRNQRD-LK-GLF 242

  Fly  1426 ---AAFLEMESKFYLYALYNKNKPKSDTLLSEYGSSFFKPKQMQLQDKLDLASYLLKPVQRMGKY 1487
               ||..|..| ||.|..:...| ||...|.:....:.:..|.|::|||.:.|:|::|:||:.:|
  Fly   243 DEFAAHFEKNS-FYCYVSFTMGK-KSSMQLRQDNRLWLQTYQTQIKDKLGIDSFLVQPIQRLTRY 305

  Fly  1488 ALLLQQLVK-------ACKGVEGAALQ---------EIAADVEELQRAEEMVKFQLRHGNDLLAM 1536
            .|||||.:.       :||.|..|..:         ::....||:...||:        |:|   
  Fly   306 PLLLQQFISEFYKSGISCKPVLTAVCKLETRMRRALDVVNQAEEIPNIEEL--------NEL--- 359

  Fly  1537 DSLRDCDVNVKEQGRLLRQNEFLVWQGRGGKKTLRQVFLFEELVLFSKARR----FPDHKN---- 1593
                    :|.:.|...|..||........||...:||||:..::.::.|:    :..|.|    
  Fly   360 --------DVLQLGNFRRATEFDAQHFPTRKKYRSKVFLFDRCLVCTEVRKKRLAYRQHYNWEHV 416

  Fly  1594 -----LDIYIYKNSIKTSDIGLTAHTGDSATKFEIWFRKRKPDDTWMLQCMSEDIKNAWTEEISK 1653
                 || .:..|:.|..::.:....|.|:..     .||   :.:........:...|.:...|
  Fly   417 ELQRPLD-SVSSNANKIINLLVKQEEGGSSVG-----SKR---EEYSFMAAEASVVKQWLQATHK 472

  Fly  1654 LLWKQAKRNREVR 1666
            ::  :..||...|
  Fly   473 II--EIARNEHAR 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PuraNP_996016.2 PX_domain 15..>52 CDD:295365
RhoGEF 1353..1532 CDD:279015 62/201 (31%)
PH_puratrophin-1 1524..1663 CDD:270062 27/151 (18%)
PH 1562..1655 CDD:278594 19/105 (18%)
CG15611NP_611189.2 RhoGEF 167..313 CDD:238091 54/149 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0689
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.