DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Ralyl

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001343965.1 Gene:Ralyl / 76897 MGIID:1924147 Length:307 Species:Mus musculus


Alignment Length:240 Identity:66/240 - (27%)
Similarity:107/240 - (44%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDAR 68
            ::.||.||..||:::|||:|:|||||....|.|:|.:|..||::.|.|:||||||||:.:...||
Mouse    19 TQTSNITNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHAR 83

  Fly    69 NACHGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQ--------------NVSKTGNDWDYFYDS 117
            .|..||:.:.:..|.||:||..|||.:  :.|.||.              :|.....|:||:.|.
Mouse    84 AAVAGENARVIAGQPLDINMAGEPKPYRPKPGSKRPLSALYRLESKEPFLSVGGYVFDYDYYRDD 148

  Fly   118 YCSSAL----------------------------------LRGGGGAGGGGSNGVRAK-KRKRLM 147
            :.:...                                  ::||..:..|||:...:| |...|.
Mouse   149 FYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTVGGSSSSGSKLKSDELQ 213

  Fly   148 TNGGGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQ 192
            |        ::::..|......::.........||:.:.:.|::|
Mouse   214 T--------IKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 37/77 (48%)
RRM_hnRNPC_like 20..87 CDD:240787 32/66 (48%)
RalylNP_001343965.1 RRM_SF 29..111 CDD:418427 40/81 (49%)
XhlA 215..>260 CDD:402419 5/36 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9100
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm43461
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.970

Return to query results.
Submit another query.