DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and tra2b

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001006878.1 Gene:tra2b / 448667 XenbaseID:XB-GENE-5864557 Length:293 Species:Xenopus tropicalis


Alignment Length:163 Identity:42/163 - (25%)
Similarity:68/163 - (41%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QTNSQDPQAVNSRIFVGN---------LNTFQCS----KTDVERMFQIYGRLAGISM-------- 52
            :::|..|.:...| .|||         |..|..|    :.|:..:|..||.::.:|:        
 Frog    98 RSHSHSPMSTRRR-HVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRR 161

  Fly    53 HKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAH------QIGRKRQNVSKTGNDW 111
            .:|::||.|.|..||:.|....:|..:..:.:.|:.....:.|      .:||.....|:..:.:
 Frog   162 SRGFSFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYY 226

  Fly   112 DYFYD-------SYCSSALLRGGGGAGGGGSNG 137
            |..||       .|.|.: .|||||.|||...|
 Frog   227 DRGYDRGGYDDREYYSRS-YRGGGGGGGGWRGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 24/98 (24%)
RRM_hnRNPC_like 20..87 CDD:240787 21/87 (24%)
tra2bNP_001006878.1 RRM_SF 113..201 CDD:388407 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.