DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and hnrnpc

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_012815605.1 Gene:hnrnpc / 448664 XenbaseID:XB-GENE-489141 Length:343 Species:Xenopus tropicalis


Alignment Length:219 Identity:70/219 - (31%)
Similarity:113/219 - (51%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||:::|||:|:|||||....|.|||.:|..||::.|.|:||||||||::|..:||.|.
 Frog    64 SNVTNKTDPRSMNSRVFIGNLNTLVVKKADVEAIFSKYGKIVGCSVHKGYAFVQYSNERNARTAV 128

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQNVSKTGNDWDY-------FYDSYCS------- 120
            .||||:.:..|.:|:|:.|||||:  :.|.||......|:.:|.       :||||.:       
 Frog   129 AGEDGRMIAGQVMDINLAAEPKANRSKTGVKRSAADMYGSSFDLEYDFQRDYYDSYSATRVPPPP 193

  Fly   121 --------SALLRGGGGAGGGGSNGVRAKKRKRLMTNGGGLAVAVQQQQQQHHHSAAAVAAAAAA 177
                    |...|..|.|...|.:|..:|..:|   .|...:..::....|......:.......
 Frog   194 PIARAVVPSKRQRVSGNASRRGKSGFNSKSGQR---GGSSKSSRLKGDDLQAIKKELSQIKQRVD 255

  Fly   178 AVHQQQQQVQQQQQQQHHQQQQQQ 201
            ::.:..::::::|.:|..:..::|
 Frog   256 SLLENLERIEREQSKQDIKLDEEQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 40/77 (52%)
RRM_hnRNPC_like 20..87 CDD:240787 35/66 (53%)
hnrnpcXP_012815605.1 RRM_hnRNPC 76..146 CDD:241047 37/69 (54%)
APG6_N <229..322 CDD:375248 4/51 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm48616
Panther 1 1.100 - - LDO PTHR13968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8797
SonicParanoid 1 1.000 - - X853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.