DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and srsf5a

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_031746174.1 Gene:srsf5a / 448104 XenbaseID:XB-GENE-5954653 Length:297 Species:Xenopus tropicalis


Alignment Length:132 Identity:34/132 - (25%)
Similarity:58/132 - (43%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLD 85
            |:|:|.|:. ...:.|||:.|:.|||:..|::..|:.||:|.:..||.:|.:..:||.:.::.:.
 Frog    40 RVFIGRLSP-HARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKVLCNERVT 103

  Fly    86 VNMVAEPKAHQIGRKRQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG 150
            :         :..|.|:.                     |||...||||..|....:.....:|.
 Frog   104 I---------EHARNRRG---------------------RGGMMGGGGGGGGRYPNRFAYRQSNS 138

  Fly   151 GG 152
            ||
 Frog   139 GG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 21/67 (31%)
RRM_hnRNPC_like 20..87 CDD:240787 21/65 (32%)
srsf5aXP_031746174.1 RRM1_SRSF4_like 40..108 CDD:409774 21/77 (27%)
RRM2_SRSF4_like 152..223 CDD:410012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.