DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42458 and srsf6a

DIOPT Version :9

Sequence 1:	NP_996010.2	Gene:	CG42458 / 2768945	FlyBaseID:	FBgn0259935	Length:	711	Species:	Drosophila melanogaster
Sequence 2:	XP_005161979.1	Gene:	srsf6a / 406775	ZFINID:	ZDB-GENE-040426-2824	Length:	400	Species:	Danio rerio

Alignment Length:	132	Identity:	38/132 - (28%)
Similarity:	58/132 - (43%)	Gaps:	39/132 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 RIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLD 85
            |:::|.| ::...:.|::|.|..||:|..:.:..||.||:|.:..||.:|.:..:||.:..:.:.
Zfish     3 RVYIGRL-SYHVREKDIQRFFSGYGKLLEVDLKNGYGFVEFEDTRDADDAVYELNGKELCGERVM 66

  Fly    86 VNMVAEPKAHQIGRKRQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG 150
            |.       |..|.:|..            |||       ||||.||||..|            |
Zfish    67 VE-------HARGPRRDR------------DSY-------GGGGGGGGGGGG------------G 93

  Fly   151 GG 152
            ||
Zfish    94 GG 95

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42458	NP_996010.2	RRM	<11..>89	CDD:223796	20/67 (30%)
CG42458	NP_996010.2	RRM_hnRNPC_like	20..87	CDD:240787	19/65 (29%)
srsf6a	XP_005161979.1	RRM	<3..137	CDD:223796	38/132 (29%)
		RRM_SF	3..72	CDD:302621	21/76 (28%)
		RRM2_SRSF4_like	135..206	CDD:241044
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1315388at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.920