DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Srsf4

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001102155.1 Gene:Srsf4 / 362612 RGDID:1561347 Length:488 Species:Rattus norvegicus


Alignment Length:93 Identity:27/93 - (29%)
Similarity:51/93 - (54%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLD 85
            |:::|.| ::|..:.||||.|:.||::..:.:..||.||:|.:..||.:|.:..:||.:..:.:.
  Rat     3 RVYIGRL-SYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVI 66

  Fly    86 VNMVAEPK---AHQIGRKRQNVSKTGND 110
            |.....|:   ::..||......::|.|
  Rat    67 VEHARGPRRDGSYGSGRSGYGYRRSGRD 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 22/67 (33%)
RRM_hnRNPC_like 20..87 CDD:240787 21/65 (32%)
Srsf4NP_001102155.1 RRM1_SRSF4_like 3..72 CDD:240783 22/69 (32%)
RRM2_SRSF4_like 104..175 CDD:241044
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.