DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and HNRNPCL1

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001013653.1 Gene:HNRNPCL1 / 343069 HGNCID:29295 Length:293 Species:Homo sapiens


Alignment Length:235 Identity:73/235 - (31%)
Similarity:119/235 - (50%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||.::|||:|:|||||....|:|||.:|..||::||.|:|||:||||:....:||.|.
Human     3 SNVTNKMDPHSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKEKNARAAV 67

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAHQ--IGRKRQNVSKTGN--DWDY-----FYDSYCS------- 120
            .||||:.:.||.:|:|:.||||.::  .|.||......|:  |.||     :||...|       
Human    68 AGEDGRMIASQVVDINLAAEPKVNRGNAGVKRSAAEMYGSSFDLDYGFQRDYYDGMYSFPARVPP 132

  Fly   121 ----------SALLRGGGGAGGGGSNGVRAKKRKRLMTNGGGL----AVAVQQQQQQHHHSAAAV 171
                      |...|..|.....|.:|..:|..||..:..|.|    ..|::|:..|......::
Human   133 PPPIALAVVPSKRQRLSGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSL 197

  Fly   172 AAAAAAAVHQQQQQVQQQQQQQHHQQQQQQHQQQVAAVAM 211
            .        :..::::::|.:|..:.:..:.:::.::.:|
Human   198 L--------ENLEKIEKEQSKQEVEVKNAKSEEEQSSSSM 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 40/77 (52%)
RRM_hnRNPC_like 20..87 CDD:240787 35/66 (53%)
HNRNPCL1NP_001013653.1 RRM_hnRNPC_like 16..83 CDD:240787 35/66 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..177 10/39 (26%)
Drc1-Sld2 <171..288 CDD:314562 8/67 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..293 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm41408
orthoMCL 1 0.900 - - OOG6_106780
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.