DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Ralyl

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_017446211.1 Gene:Ralyl / 294883 RGDID:1305844 Length:318 Species:Rattus norvegicus


Alignment Length:240 Identity:66/240 - (27%)
Similarity:107/240 - (44%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDAR 68
            ::.||.||..||:::|||:|:|||||....|.|:|.:|..||::.|.|:||||||||:.:...||
  Rat    30 TQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHAR 94

  Fly    69 NACHGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQ--------------NVSKTGNDWDYFYDS 117
            .|..||:.:.:..|.||:||..|||.:  :.|.||.              :|.....|:||:.|.
  Rat    95 AAVAGENARVIAGQPLDINMAGEPKPYRPKPGSKRPLSALYRLESKEPFLSVGGYVFDYDYYRDD 159

  Fly   118 YCSSAL----------------------------------LRGGGGAGGGGSNGVRAK-KRKRLM 147
            :.:...                                  ::||..:..|||:...:| |...|.
  Rat   160 FYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSSVGGSSSSGSKLKSDELQ 224

  Fly   148 TNGGGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQ 192
            |        ::::..|......::.........||:.:.:.|::|
  Rat   225 T--------IKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 37/77 (48%)
RRM_hnRNPC_like 20..87 CDD:240787 32/66 (48%)
RalylXP_017446211.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.