DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Hnrnpc

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001264529.1 Gene:Hnrnpc / 290046 RGDID:1309982 Length:313 Species:Rattus norvegicus


Alignment Length:261 Identity:73/261 - (27%)
Similarity:118/261 - (45%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||:::|||:|:|||||....|:|||.:|..||::.|.|:|||:||||:.|..:||.|.
  Rat     3 SNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAV 67

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQNVSKTGN-----------------DWDY---F 114
            .||||:.:..|.||:|:.||||.:  :.|.||......|:                 |:|:   :
  Rat    68 AGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVPEHPSPSPLLSSSFDLDYDFQRDY 132

  Fly   115 YDSYCS-----------------SALLRGGGGAGGGGSNGVRAKKRKRLMTNGGGL-----AVAV 157
            ||...|                 |...|..|.....|.:|..:|..:|..::..|.     ..|:
  Rat   133 YDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDDLQAI 197

  Fly   158 QQQQQQHHHSAAAVAAAAAAAVHQQQQQ--------VQQQQQQQHHQQQQQQHQQQVAAVAMAAM 214
            :::..|......::..:......:|.:|        |:.:.::...:|.....::....|.|.:.
  Rat   198 KKELTQIKQKVDSLLESLEKIEKEQSKQADLSFSSPVEMKNEKSEEEQSSASVKKDETNVKMESE 262

  Fly   215 A 215
            |
  Rat   263 A 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 40/77 (52%)
RRM_hnRNPC_like 20..87 CDD:240787 35/66 (53%)
HnrnpcNP_001264529.1 RRM_hnRNPC 10..93 CDD:410015 43/82 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8902
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm45524
orthoMCL 1 0.900 - - OOG6_106780
Panther 1 1.100 - - LDO PTHR13968
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X853
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.