DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Srsf9

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_038945194.1 Gene:Srsf9 / 288701 RGDID:1309495 Length:247 Species:Rattus norvegicus


Alignment Length:144 Identity:40/144 - (27%)
Similarity:62/144 - (43%) Gaps:25/144 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHK-----GYAFVQFTNPFDARNACHGEDGKT 78
            :.||:||||.| ...:.|:|.:|..|||:..|.:..     .:|||:|.:|.....|..|.:.|:
  Rat    13 DGRIYVGNLPT-DVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRHGLRALTGRNSKS 76

  Fly    79 VLSQTLDVNMVAEPKAHQI-GRKRQNVSKTGNDWDYFYDSYCSSAL--LRGGGGAGG---GGSNG 137
            ..|..|.:.::.......| ||         |.:||   ..|...:  .|..||.||   ...||
  Rat    77 QRSAFLWLPLLVTDAEDAIYGR---------NGYDY---GQCRLRVEFPRAYGGRGGWPRASRNG 129

  Fly   138 VRAKKRK-RLMTNG 150
            ...::.. |::.:|
  Rat   130 PPTRRSDFRVLVSG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 24/74 (32%)
RRM_hnRNPC_like 20..87 CDD:240787 24/71 (34%)
Srsf9XP_038945194.1 RRM1_SRSF9 15..112 CDD:241042 31/109 (28%)
RRM2_SRSF9 129..212 CDD:410161 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.