DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and nab3

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_593002.1 Gene:nab3 / 2543638 PomBaseID:SPAC3H8.09c Length:738 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:47/153 - (30%)
Similarity:74/153 - (48%) Gaps:25/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDAR 68
            |.:||....|.|.|  ||:|:|:|||...||.::.::|:|||.||.|.:...|.||||....|..
pombe   349 SIMSNWYPGQFPSA--SRLFLGHLNTKSLSKRNLWKVFKIYGPLAQIVLKANYGFVQFFTNEDCA 411

  Fly    69 NACHGEDGKTVLSQT--LDVNMVAEPKAHQIG--RKRQNVSKTGNDWDYFYDS--YCSSALLRGG 127
            .|.:.|.|..|..|.  |:::.:.:...:||.  :|..:|:|: |.:.....:  |.:|:     
pombe   412 RALNAEQGNFVRGQKLHLEISKIQKKYQNQIENMKKGSHVTKS-NQYSEMIGNLPYPTSS----- 470

  Fly   128 GGAGGGGSNGVRAKKRKRLMTNG 150
                       |.:.|..||:.|
pombe   471 -----------RKRTRSPLMSKG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 31/79 (39%)
RRM_hnRNPC_like 20..87 CDD:240787 28/68 (41%)
nab3NP_593002.1 RRM 256..503 CDD:223796 47/153 (31%)
RRM_Nab3p 364..434 CDD:240788 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3452
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - oto101324
orthoMCL 1 0.900 - - OOG6_106780
Panther 1 1.100 - - LDO PTHR13968
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8797
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.