DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Srsf5

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001334344.1 Gene:Srsf5 / 20384 MGIID:98287 Length:270 Species:Mus musculus


Alignment Length:125 Identity:36/125 - (28%)
Similarity:54/125 - (43%) Gaps:34/125 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLD 85
            |:|:|.||.....| ||||.|:.|||:..|.:.:|:.||:|.:|.||.:|.:..|||.:.|:.:.
Mouse     5 RVFIGRLNPAAREK-DVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVT 68

  Fly    86 VNMVAEPKAHQIGRKRQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKR 145
            :.       |...|.|                          ||.|.|..:...:.:|.|
Mouse    69 IE-------HARARSR--------------------------GGRGRGRYSDRFSSRRPR 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 27/67 (40%)
RRM_hnRNPC_like 20..87 CDD:240787 27/65 (42%)
Srsf5NP_001334344.1 RRM1_SRSF5 5..74 CDD:410008 28/76 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..105 8/49 (16%)
RRM2_SRSF5 99..179 CDD:410158
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.