DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and Raly

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001132985.1 Gene:Raly / 19383 MGIID:97850 Length:312 Species:Mus musculus


Alignment Length:310 Identity:83/310 - (26%)
Similarity:115/310 - (37%) Gaps:119/310 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||:::|||:|:|||||....|:|||.:|..|||:||.|:||||||||:.|...||.|.
Mouse     8 SNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARAAV 72

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAHQ-IGRKRQNV---SKTGNDWDYFYDSYCS------------ 120
            .||:|:.:..||||:||..|||.:: .|.||...   |....|:||:.|.:|:            
Mouse    73 LGENGRVLAGQTLDINMAGEPKPNRPKGLKRAATAIYSGYSFDYDYYQDYFCARLFDYRGRLSPV 137

  Fly   121 ----------------------------------------------------------------S 121
                                                                            .
Mouse   138 PVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNID 202

  Fly   122 ALL-------------------------RGGGGAGGGGSNGVRAKKRKRLMTNGGGLAVAVQQQQ 161
            |||                         .|||.:|||||:.|           |||.:.......
Mouse   203 ALLGRLEQIAEEQKANPDGKKKGDSSSGGGGGSSGGGGSSNV-----------GGGSSGGSGSCS 256

  Fly   162 QQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQQ---HHQQQQQQHQQQVAA 208
            ......|.....|:.|...|.:.|.:....::   .|.:::.:|.|...|
Mouse   257 SSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEEELEHSQDTDA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 43/77 (56%)
RRM_hnRNPC_like 20..87 CDD:240787 38/66 (58%)
RalyNP_001132985.1 RRM_RALY 20..95 CDD:410016 43/74 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..312 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9100
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm43461
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.970

Return to query results.
Submit another query.