DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42458 and rsp-1

DIOPT Version :9

Sequence 1:	NP_996010.2	Gene:	CG42458 / 2768945	FlyBaseID:	FBgn0259935	Length:	711	Species:	Drosophila melanogaster
Sequence 2:	NP_496442.1	Gene:	rsp-1 / 174748	WormBaseID:	WBGene00004698	Length:	312	Species:	Caenorhabditis elegans

Alignment Length:	133	Identity:	38/133 - (28%)
Similarity:	60/133 - (45%)	Gaps:	34/133 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 SRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTL 84
            :||::|.| |.:.|:.|:|..|:.||::..:.:..|:.||:|.:..||.:|.|..:||
Worm     3 ARIYIGRL-TSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGK------- 59

  Fly    85 DVNMVAEPKAHQIGRKRQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTN 149
                       ::|.:|..:       ||        :..|||||..||...|.|...|....:.
Worm    60 -----------ELGGERVIL-------DY--------SKPRGGGGDRGGFGGGGRGGARVSSYSG 98

  Fly   150 GGG 152
            |||
Worm    99 GGG 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42458	NP_996010.2	RRM	<11..>89	CDD:223796	21/68 (31%)
CG42458	NP_996010.2	RRM_hnRNPC_like	20..87	CDD:240787	21/66 (32%)
rsp-1	NP_496442.1	RRM	<3..180	CDD:223796	38/133 (29%)
		RRM1_SRSF4_like	4..73	CDD:240783	25/102 (25%)
		RRM2_SRSF4_like	129..200	CDD:241044
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1315388at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010