DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and rsp-5

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_495307.3 Gene:rsp-5 / 174073 WormBaseID:WBGene00004702 Length:208 Species:Caenorhabditis elegans


Alignment Length:92 Identity:34/92 - (36%)
Similarity:48/92 - (52%) Gaps:16/92 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTV--LSQT 83
            |:::|.: .:...:.||||..:.||::..|||..|:|||.|.:..||.:|||..||||:  .|..
 Worm     3 RLYLGKI-PYNARERDVERFLKGYGKINNISMKYGFAFVDFEDSRDAEDACHDLDGKTMEGSSMR 66

  Fly    84 LDVNMVAEPKAHQIGRKRQNVSKTGND 110
            |.|.|..       |:.|      |||
 Worm    67 LVVEMAR-------GKPR------GND 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 28/69 (41%)
RRM_hnRNPC_like 20..87 CDD:240787 27/67 (40%)
rsp-5NP_495307.3 RRM <3..>77 CDD:223796 30/81 (37%)
RRM_SF 3..74 CDD:302621 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1315388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.