DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and RALYL

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001093861.1 Gene:RALYL / 138046 HGNCID:27036 Length:304 Species:Homo sapiens


Alignment Length:286 Identity:71/286 - (24%)
Similarity:122/286 - (42%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDAR 68
            ::.||.||..||:::|||:|:|||||....|.|:|.:|..||::.|.|:||||||||:.:...||
Human    18 TQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHAR 82

  Fly    69 NACHGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQ--------------NVSKTGNDWDYFYDS 117
            .|..||:.:.:..|.||:||..|||.:  :.|.||.              :|.....|:||:.|.
Human    83 AAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDD 147

  Fly   118 YCSSAL----------------------------------LRGGGGAGGGGSNGVRAKKRKRLMT 148
            :.:...                                  ::||..:...||.|.:.|. ..|.|
Human   148 FYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKS-DELQT 211

  Fly   149 NGGGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQQHHQQQQQQHQQQVAAVAMAA 213
                    ::::..|......::..        :.:::::||:.:...|::|.            
Human   212 --------IKKELTQIKTKIDSLLG--------RLEKIEKQQKAEAEAQKKQL------------ 248

  Fly   214 MANLLPQQQLLLHQQNLLSNAAVATT 239
                  ::.|:|.|:..:|..|..:|
Human   249 ------EESLVLIQEECVSEIADHST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 37/77 (48%)
RRM_hnRNPC_like 20..87 CDD:240787 32/66 (48%)
RALYLNP_001093861.1 RRM_SF 28..110 CDD:418427 40/81 (49%)
XhlA 212..>257 CDD:402419 7/70 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm41408
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.