DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and HNRNPCL4

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001289480.1 Gene:HNRNPCL4 / 101060301 HGNCID:51333 Length:293 Species:Homo sapiens


Alignment Length:234 Identity:74/234 - (31%)
Similarity:111/234 - (47%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||.::|||:|:|||||....|:|||.:|..||::||.|:|||:||||:....:||.|.
Human     3 SNVTNKMDPHSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKEKNARAAV 67

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAHQ--IGRKRQNVSKTGNDWDYFY----DSY------------ 118
            .||||:.:.||.:|:|:.||||.::  .|.||......|:.:|..|    |.|            
Human    68 AGEDGRMIASQVVDINLAAEPKVNRGNAGVKRSAAEMYGSSFDLDYNLQRDYYGGMYSFPARVPP 132

  Fly   119 --------CSSALLRGGGGAGGGGSNGVRAKKRKRLMTNGGGLAVAVQQQQQQHHHSAAAVAAAA 175
                    ..|...|..|.....|.:|..:|..||..:..|.|.....|                
Human   133 PPPIALAVVPSKRQRISGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQ---------------- 181

  Fly   176 AAAVHQQQQQVQQQQQQ--QHHQQQQQQHQQQVAAVAMA 212
              |:.|:..|::|:...  ::.::.:::|.:|...|..|
Human   182 --AIKQELTQIKQKVDSLLENLEKIEKEHCKQGVEVKNA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 40/77 (52%)
RRM_hnRNPC_like 20..87 CDD:240787 35/66 (53%)
HNRNPCL4NP_001289480.1 RRM_SF 10..93 CDD:418427 43/82 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..177 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..293 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9051
eggNOG 1 0.900 - - E33208_3BCXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm41408
orthoMCL 1 0.900 - - OOG6_106780
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.