DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and raly

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_004918583.1 Gene:raly / 100497634 XenbaseID:XB-GENE-489839 Length:300 Species:Xenopus tropicalis


Alignment Length:116 Identity:56/116 - (48%)
Similarity:75/116 - (64%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDARNAC 71
            ||.||..||:::|||:|:|||||....|:|||.:|..|||:.|.|:||||||||:.|...||.|.
 Frog     8 SNITNKNDPKSLNSRVFIGNLNTAVVKKSDVESIFSKYGRVVGCSVHKGYAFVQYLNERHARGAV 72

  Fly    72 HGEDGKTVLSQTLDVNMVAEPKAHQ-IGRKRQNVSKTGN---DWDYFYDSY 118
            .||:|:.:..||||:||..|||.:: .|.||...:....   |.||:.|.:
 Frog    73 IGENGRVLAGQTLDINMAGEPKPNRPKGLKRAAAALYSGYDLDLDYYRDDF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 42/77 (55%)
RRM_hnRNPC_like 20..87 CDD:240787 37/66 (56%)
ralyXP_004918583.1 RRM_RALY 20..95 CDD:410016 42/74 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 1 1.000 - - otm48616
Panther 1 1.100 - - O PTHR13968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.