DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42458 and ralyl

DIOPT Version :9

Sequence 1:NP_996010.2 Gene:CG42458 / 2768945 FlyBaseID:FBgn0259935 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_005163570.1 Gene:ralyl / 100148343 ZFINID:ZDB-GENE-060607-5 Length:278 Species:Danio rerio


Alignment Length:120 Identity:53/120 - (44%)
Similarity:80/120 - (66%) Gaps:5/120 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGISMHKGYAFVQFTNPFDAR 68
            ::.||.||..||:::|||:|:|||||....|||:|.:|..||::.|.|:|||:||||:....:||
Zfish     5 TQTSNITNKTDPRSLNSRVFIGNLNTAVVKKTDIELIFAKYGKITGCSVHKGFAFVQYACERNAR 69

  Fly    69 NACHGEDGKTVLSQTLDVNMVAEPKAH--QIGRKRQNVSKTGNDWDY-FY--DSY 118
            :|..||:.:.:..||||:||..||:.:  ::..||.....:|.::|| ||  |.|
Zfish    70 SAVAGENTRVLAGQTLDINMAGEPRPYRPKVASKRPFSLYSGYEFDYDFYRDDFY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42458NP_996010.2 RRM <11..>89 CDD:223796 38/77 (49%)
RRM_hnRNPC_like 20..87 CDD:240787 33/66 (50%)
ralylXP_005163570.1 RRM <7..>112 CDD:223796 46/104 (44%)
RRM_SF 20..95 CDD:302621 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.